Antibody data

Product number
H00008717-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008717-M01, RRID:AB_1137509
Product name
TRADD monoclonal antibody (M01), clone 3G1
Provider product page
Abnova Corporation - H00008717-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TRADD.
Antigen sequence
LFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSL
QRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRF
VQAEGRRATLQRLVEALEENELTSLAEDLLGLTDP
NGGLA
Isotype
IgG
Antibody clone number
3G1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -