Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008717-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008717-M01, RRID:AB_1137509
- Product name
- TRADD monoclonal antibody (M01), clone 3G1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TRADD.
- Antigen sequence
LFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSL
QRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRF
VQAEGRRATLQRLVEALEENELTSLAEDLLGLTDP
NGGLA- Isotype
- IgG
- Antibody clone number
- 3G1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TRADD monoclonal antibody (M01), clone 3G1. Western Blot analysis of TRADD expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to TRADD on HeLa cell . [antibody concentration 20 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol