HPA020599

TRAF6 antibody from Atlas Antibodies
RNF85
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020599
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020599, RRID:AB_1858232
Product name
Anti-TRAF6
Provider product page
Atlas Antibodies - HPA020599
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQ
SMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIG
NFGMHLKCQEEEKPV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -