Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- Immunocytochemistry [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90544 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90544, RRID:AB_2665581
- Product name
- Anti-SIX1
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
CFKEKSRGVLREWYAHNPYPSPREKRELAEATGLT
TTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNK
QNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLL
QGNMGHARSSNYSLPGLTASQPSHGLQTHQHQLQD
S- Isotype
- IgG
- Antibody clone number
- CL0185
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SIX1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human cell line RH-30 Lane 3: Human cell line CACO-2
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis of extracts from RH-30 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-SIX1 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-PPIB monoclonal antibody was used as loading control.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining in RH30 cell line with Anti-SIX1 monoclonal antibody, showing spotty nuclear staining in green. Microtubule probes are visualized in red (where available).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human striated muscle shows strong nuclear immunoreactivity in the myocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows absence of immunoreactivity (negative control).