Antibody data
- Antibody Data
- Antigen structure
- References [14]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001893 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001893, RRID:AB_1079991
- Product name
- Anti-SIX1
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
CFKEKSRGVLREWYAHNPYPSPREKRELAEATGLT
TTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNK
QNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLL
QGNMGHARSSNYSLPGLTASQPSHGLQTHQHQLQD
S- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The homeoprotein SIX1 controls cellular senescence through the regulation of p16INK4A and differentiation-related genes.
The Six1 oncoprotein downregulates p53 via concomitant regulation of RPL26 and microRNA-27a-3p.
Overexpression of sineoculis homeobox homolog 1 predicts poor prognosis of hepatocellular carcinoma.
Six homeoproteins and a Iinc-RNA at the fast MYH locus lock fast myofiber terminal phenotype.
3D mouse embryonic stem cell culture for generating inner ear organoids
Persistently altered epigenetic marks in the mouse uterus after neonatal estrogen exposure.
Six1 regulates stem cell repair potential and self-renewal during skeletal muscle regeneration.
The miR-106b-25 cluster targets Smad7, activates TGF-β signaling, and induces EMT and tumor initiating cell characteristics downstream of Six1 in human breast cancer
SIX1 promotes epithelial–mesenchymal transition in colorectal cancer through ZEB1 activation
Expression of Six1 in luminal breast cancers predicts poor prognosis and promotes increases in tumor initiating cells by activation of extracellular signal-regulated kinase and transforming growth factor-beta signaling pathways
Eya2 is required to mediate the pro-metastatic functions of Six1 via the induction of TGF-β signaling, epithelial–mesenchymal transition, and cancer stem cell properties
The Six1 homeoprotein induces human mammary carcinoma cells to undergo epithelial-mesenchymal transition and metastasis in mice through increasing TGF-β signaling
Six1 expands the mouse mammary epithelial stem/progenitor cell pool and induces mammary tumors that undergo epithelial-mesenchymal transition
Gene expression changes during HPV-mediated carcinogenesis: a comparison between an in vitro cell model and cervical cancer.
Adrados I, Larrasa-Alonso J, Galarreta A, López-Antona I, Menéndez C, Abad M, Gil J, Moreno-Bueno G, Palmero I
Oncogene 2016 Jul 7;35(27):3485-94
Oncogene 2016 Jul 7;35(27):3485-94
The Six1 oncoprotein downregulates p53 via concomitant regulation of RPL26 and microRNA-27a-3p.
Towers CG, Guarnieri AL, Micalizzi DS, Harrell JC, Gillen AE, Kim J, Wang CA, Oliphant MUJ, Drasin DJ, Guney MA, Kabos P, Sartorius CA, Tan AC, Perou CM, Espinosa JM, Ford HL
Nature communications 2015 Dec 21;6:10077
Nature communications 2015 Dec 21;6:10077
Overexpression of sineoculis homeobox homolog 1 predicts poor prognosis of hepatocellular carcinoma.
Kong J, Zhou X, Liu S, Jin T, Piao Y, Liu C, Lin Z
International journal of clinical and experimental pathology 2014;7(6):3018-27
International journal of clinical and experimental pathology 2014;7(6):3018-27
Six homeoproteins and a Iinc-RNA at the fast MYH locus lock fast myofiber terminal phenotype.
Sakakibara I, Santolini M, Ferry A, Hakim V, Maire P
PLoS genetics 2014;10(5):e1004386
PLoS genetics 2014;10(5):e1004386
3D mouse embryonic stem cell culture for generating inner ear organoids
Koehler K, Hashino E
Nature Protocols 2014 May;9(6):1229-1244
Nature Protocols 2014 May;9(6):1229-1244
Persistently altered epigenetic marks in the mouse uterus after neonatal estrogen exposure.
Jefferson WN, Chevalier DM, Phelps JY, Cantor AM, Padilla-Banks E, Newbold RR, Archer TK, Kinyamu HK, Williams CJ
Molecular endocrinology (Baltimore, Md.) 2013 Oct;27(10):1666-77
Molecular endocrinology (Baltimore, Md.) 2013 Oct;27(10):1666-77
Six1 regulates stem cell repair potential and self-renewal during skeletal muscle regeneration.
Le Grand F, Grifone R, Mourikis P, Houbron C, Gigaud C, Pujol J, Maillet M, Pagès G, Rudnicki M, Tajbakhsh S, Maire P
The Journal of cell biology 2012 Sep 3;198(5):815-32
The Journal of cell biology 2012 Sep 3;198(5):815-32
The miR-106b-25 cluster targets Smad7, activates TGF-β signaling, and induces EMT and tumor initiating cell characteristics downstream of Six1 in human breast cancer
Smith A, Iwanaga R, Drasin D, Micalizzi D, Vartuli R, Tan A, Ford H
Oncogene 2012 January;31(50):5162-5171
Oncogene 2012 January;31(50):5162-5171
SIX1 promotes epithelial–mesenchymal transition in colorectal cancer through ZEB1 activation
Ono H, Imoto I, Kozaki K, Tsuda H, Matsui T, Kurasawa Y, Muramatsu T, Sugihara K, Inazawa J
Oncogene 2012 January;31(47):4923-4934
Oncogene 2012 January;31(47):4923-4934
Expression of Six1 in luminal breast cancers predicts poor prognosis and promotes increases in tumor initiating cells by activation of extracellular signal-regulated kinase and transforming growth factor-beta signaling pathways
Iwanaga R, Wang C, Micalizzi D, Harrell J, Jedlicka P, Sartorius C, Kabos P, Farabaugh S, Bradford A, Ford H
Breast Cancer Research 2012 ;14(4)
Breast Cancer Research 2012 ;14(4)
Eya2 is required to mediate the pro-metastatic functions of Six1 via the induction of TGF-β signaling, epithelial–mesenchymal transition, and cancer stem cell properties
Farabaugh S, Micalizzi D, Jedlicka P, Zhao R, Ford H
Oncogene 2011 June
Oncogene 2011 June
The Six1 homeoprotein induces human mammary carcinoma cells to undergo epithelial-mesenchymal transition and metastasis in mice through increasing TGF-β signaling
Micalizzi D, Christensen K, Jedlicka P, Coletta R, Barón A, Harrell J, Horwitz K, Billheimer D, Heichman K, Welm A, Schiemann W, Ford H
Journal of Clinical Investigation 2009 September;119(9):2678-2690
Journal of Clinical Investigation 2009 September;119(9):2678-2690
Six1 expands the mouse mammary epithelial stem/progenitor cell pool and induces mammary tumors that undergo epithelial-mesenchymal transition
McCoy E, Iwanaga R, Jedlicka P, Abbey N, Chodosh L, Heichman K, Welm A, Ford H
Journal of Clinical Investigation 2009 September;119(9):2663-2677
Journal of Clinical Investigation 2009 September;119(9):2663-2677
Gene expression changes during HPV-mediated carcinogenesis: a comparison between an in vitro cell model and cervical cancer.
Wan F, Miao X, Quraishi I, Kennedy V, Creek KE, Pirisi L
International journal of cancer 2008 Jul 1;123(1):32-40
International journal of cancer 2008 Jul 1;123(1):32-40
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SIX1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and SIX1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401814).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human skeletal muscle and liver tissues using HPA001893 antibody. Corresponding SIX1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows strong nuclear positivity in striated muscle fibers.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast cancer shows weak to moderate nuclear positivity in tumor cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human salivary gland shows moderate to strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
- Sample type
- HUMAN