HPA001893

SIX1 antibody from Atlas Antibodies
DFNA23
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA001893
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001893, RRID:AB_611788
Product name
Anti-SIX1
Provider product page
Atlas Antibodies - HPA001893
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CFKEKSRGVLREWYAHNPYPSPREKRELAEATGLT
TTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNK
QNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLL
QGNMGHARSSNYSLPGLTASQPSHGLQTHQHQLQD
S
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -