HPA001893

SIX1 antibody from Sigma-Aldrich
DFNA23
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001893
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001893, RRID:AB_1079991
Product name
Anti-SIX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001893
Antibody type
Polyclonal
Antigen
Homeobox protein SIX1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CFKEKSRGVLREWYAHNPYPSPREKRELAEATGLT
TTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNK
QNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLL
QGNMGHARSSNYSLPGLTASQPSHGLQTHQHQLQD
S
Storage
-20C
Provider Type Product Number
- No reagents -