PAB27989
antibody from Abnova Corporation
Targeting: APOOL
AAIR8193, CXorf33, FAM121A, Mic27, MICOS27, UNQ8193
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB27989 - Provider product page

- Provider
- Abnova Corporation
- Product name
- APOOL polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant APOOL
- Antigen sequence
ATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAV
KSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTT
HVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPK
LMDHGQSHPED- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of cell lysates with APOOL polyclonal antibody ( Cat # PAB27989 ) at 1:100-1:500 dilution.Lane 1: NIH-3T3Lane 2: NBT-II
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: RT-4 Lane 2: EFO-21 Lane 3: A-431 Lane 4: Liver Lane 5: Tonsil with APOOL polyclonal antibody ( Cat # PAB27989 ) at 1:250 - 1:500 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line A-431 with APOOL polyclonal antibody ( Cat # PAB27989 ) at 1-4 ug/ml dilution shows positivity in mitochondria.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human stomach with APOOL polyclonal antibody ( Cat # PAB27989 ) shows strong cytoplasmic positivity in glandular cells at 1:500 - 1:1000 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)