HPA000612

APOOL antibody from Sigma-Aldrich
AAIR8193, CXorf33, FAM121A, Mic27, UNQ8193
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000612
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000612, RRID:AB_1078594
Product name
Anti-APOOL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000612
Antibody type
Polyclonal
Antigen
Apolipoprotein O-like precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAV
KSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTT
HVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPK
LMDHGQSHPED
Storage
-20C
Provider Type Product Number
- No reagents -