HPA027545

ANXA11 antibody from Sigma-Aldrich
ANX11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027545
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027545, RRID:AB_1844851
Product name
Anti-ANXA11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027545
Antibody type
Polyclonal
Antigen
Annexin A11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTP
AVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGF
GTDEQ
Storage
-20C
Provider Type Product Number
- No reagents -