Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502905 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-YWHAZ antibody: synthetic peptide directed towards the middle region of human YWHAZ
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
FDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTS
DTQGD EAEAGEGGEN- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Gene-gene interaction between 14-3-3 zeta and butyrylcholinesterase modulates Alzheimer's disease risk.
Mateo I, Llorca J, Infante J, RodrÃguez-RodrÃguez E, Berciano J, Combarros O
European journal of neurology : the official journal of the European Federation of Neurological Societies 2008 Mar;15(3):219-22
European journal of neurology : the official journal of the European Federation of Neurological Societies 2008 Mar;15(3):219-22
No comments: Submit comment
No validations: Submit validation data