Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310970 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-YWHAZ antibody: synthetic peptide directed towards the C terminal of human YWHAZ
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWT
SDTQG DEAEAGEGGE- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references C-terminal recognition by 14-3-3 proteins for surface expression of membrane receptors.
Coblitz B, Shikano S, Wu M, Gabelli SB, Cockrell LM, Spieker M, Hanyu Y, Fu H, Amzel LM, Li M
The Journal of biological chemistry 2005 Oct 28;280(43):36263-72
The Journal of biological chemistry 2005 Oct 28;280(43):36263-72
No comments: Submit comment
No validations: Submit validation data