Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00027236-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00027236-M05, RRID:AB_1237644
- Product name
- ARFIP1 monoclonal antibody (M05), clone 1F10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ARFIP1.
- Antigen sequence
MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKH
SLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGGQ
RTQTKSGPVILADEIKNPAMEKLELVRKWSL- Isotype
- IgG
- Antibody clone number
- 1F10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ARFIP1 expression in transfected 293T cell line by ARFIP1 monoclonal antibody (M05), clone 1F10.Lane 1: ARFIP1 transfected lysate(41.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ARFIP1 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ARFIP1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol