Antibody data

Product number
H00027236-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027236-M05, RRID:AB_1237644
Product name
ARFIP1 monoclonal antibody (M05), clone 1F10
Provider product page
Abnova Corporation - H00027236-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ARFIP1.
Antigen sequence
MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKH
SLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGGQ
RTQTKSGPVILADEIKNPAMEKLELVRKWSL
Isotype
IgG
Antibody clone number
1F10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -