Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310749 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ARP2 Actin-Related Protein 2 Homolog (Yeast) (ACTR2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ACTR2 antibody: synthetic peptide directed towards the N terminal of human ACTR2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLT
EPPMN PTKNREKIVE- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Interaction of SPIN90 with the Arp2/3 complex mediates lamellipodia and actin comet tail formation.
Kim DJ, Kim SH, Lim CS, Choi KY, Park CS, Sung BH, Yeo MG, Chang S, Kim JK, Song WK
The Journal of biological chemistry 2006 Jan 6;281(1):617-25
The Journal of biological chemistry 2006 Jan 6;281(1):617-25
No comments: Submit comment
No validations: Submit validation data