HPA015050

ACTR2 antibody from MilliporeSigma / Merck KGaA
ARP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015050
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA015050, RRID:AB_1844556
Product name
Anti-ACTR2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA015050
Antibody type
Polyclonal
Antigen
Actin-related protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GRIIKVGGERFEAPEALFQPHLINVEGVGVAELLF
NTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLE
RELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHM
VFLGGAVLADIMKDKDNFWMTRQEYQEKGVR
Storage
-20C
Provider Type Product Number
- No reagents -