Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000640-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000640-M02, RRID:AB_509359
- Product name
- BLK monoclonal antibody (M02), clone 7A12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BLK.
- Antigen sequence
MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDA
PPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYT
AMNDRDLQMLKGEKLQVLKG- Isotype
- IgG
- Antibody clone number
- 7A12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references BANK1 and BLK act through phospholipase C gamma 2 in B-cell signaling.
Genetic and physical interaction of the B-cell systemic lupus erythematosus-associated genes BANK1 and BLK.
Bernal-Quirós M, Wu YY, Alarcón-Riquelme ME, Castillejo-López C
PloS one 2013;8(3):e59842
PloS one 2013;8(3):e59842
Genetic and physical interaction of the B-cell systemic lupus erythematosus-associated genes BANK1 and BLK.
Castillejo-López C, Delgado-Vega AM, Wojcik J, Kozyrev SV, Thavathiru E, Wu YY, Sánchez E, Pöllmann D, López-Egido JR, Fineschi S, Domínguez N, Lu R, James JA, Merrill JT, Kelly JA, Kaufman KM, Moser KL, Gilkeson G, Frostegård J, Pons-Estel BA, D'Alfonso S, Witte T, Callejas JL, Harley JB, Gaffney PM, Martin J, Guthridge JM, Alarcón-Riquelme ME
Annals of the rheumatic diseases 2012 Jan;71(1):136-42
Annals of the rheumatic diseases 2012 Jan;71(1):136-42
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BLK monoclonal antibody (M02), clone 7A12. Western Blot analysis of BLK expression in PC-12(Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of BLK expression in transfected 293T cell line by BLK monoclonal antibody (M02), clone 7A12.Lane 1: BLK transfected lysate (Predicted MW: 57.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged BLK is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol