Antibody data

Product number
H00000640-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000640-M02, RRID:AB_509359
Product name
BLK monoclonal antibody (M02), clone 7A12
Provider product page
Abnova Corporation - H00000640-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant BLK.
Antigen sequence
MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDA
PPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYT
AMNDRDLQMLKGEKLQVLKG
Isotype
IgG
Antibody clone number
7A12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -