Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310760 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-B Lymphoid Tyrosine Kinase (BLK) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-BLK antibody: synthetic peptide directed towards the middle region of human BLK
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLP
RLIDM SAQIAEGMAY- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Isoforms of the Ets transcription factor NERF/ELF-2 physically interact with AML1 and mediate opposing effects on AML1-mediated transcription of the B cell-specific blk gene.
Cho JY, Akbarali Y, Zerbini LF, Gu X, Boltax J, Wang Y, Oettgen P, Zhang DE, Libermann TA
The Journal of biological chemistry 2004 May 7;279(19):19512-22
The Journal of biological chemistry 2004 May 7;279(19):19512-22
No comments: Submit comment
No validations: Submit validation data