Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA031074 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-CTGF
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
CTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAP
CIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLC- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Renal sympathetic denervation alleviates myocardial fibrosis following isoproterenol-induced heart failure
The Hippo transducers TAZ/YAP and their target CTGF in male breast cancer
Endothelial cell dysfunction and cardiac hypertrophy in the STOX1 model of preeclampsia
Wang N, Zheng X, Qian J, Yao W, Bai L, Hou G, Qiu X, Li X, Jiang X
Molecular Medicine Reports 2017;16(4):5091-5098
Molecular Medicine Reports 2017;16(4):5091-5098
The Hippo transducers TAZ/YAP and their target CTGF in male breast cancer
Benedetto A, Mottolese M, Sperati F, Ercolani C, Lauro L, Pizzuti L, Vici P, Terrenato I, Sperduti I, Shaaban A, Sundara-Rajan S, Barba M, Speirs V, De Maria R, Maugeri-Saccà M
Oncotarget 2016;7(28):43188-43198
Oncotarget 2016;7(28):43188-43198
Endothelial cell dysfunction and cardiac hypertrophy in the STOX1 model of preeclampsia
Ducat A, Doridot L, Calicchio R, Méhats C, Vilotte J, Castille J, Barbaux S, Couderc B, Jacques S, Letourneur F, Buffat C, Le Grand F, Laissue P, Miralles F, Vaiman D
Scientific Reports 2016;6(1)
Scientific Reports 2016;6(1)
No comments: Submit comment
No validations: Submit validation data