Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054205-D01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054205-D01P, RRID:AB_1573238
- Product name
- CYCS purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human CYCS protein.
- Antigen sequence
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHG
LFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLE
NPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CYCS expression in transfected 293T cell line (H00054205-T02) by CYCS MaxPab polyclonal antibody.Lane 1: CYCS transfected lysate(11.70 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between CYCS and CASP9. HeLa cells were stained with anti-CYCS rabbit purified polyclonal 1:1200 and anti-CASP9 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)