Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005597-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005597-M02, RRID:AB_875682
- Product name
- MAPK6 monoclonal antibody (M02), clone 4C11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MAPK6.
- Antigen sequence
EVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEP
VEDGKLGERGHEEGFLNNSGEFLFNKQLESIGIPQ
FHSPVGSPLKSIQATLTPSAMKSSPQIPHQTYSSI
LKHLN- Isotype
- IgG
- Antibody clone number
- 4C11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MAPK6 monoclonal antibody (M02), clone 4C11. Western Blot analysis of MAPK6 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MAPK6 is 0.3 ng/ml as a capture antibody.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to MAPK6 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol