H00005597-M02A

MAPK6 antibody from Abnova Corporation
ERK3, HsT17250, p97MAPK, PRKM6

Antibody data

Product number
H00005597-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005597-M02A, RRID:AB_1577026
Product name
MAPK6 monoclonal antibody (M02A), clone 4C11
Provider product page
Abnova Corporation - H00005597-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MAPK6.
Antigen sequence
EVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEP
VEDGKLGERGHEEGFLNNSGEFLFNKQLESIGIPQ
FHSPVGSPLKSIQATLTPSAMKSSPQIPHQTYSSI
LKHLN
Isotype
IgG
Antibody clone number
4C11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -