Explore
Validate
Learn
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003055-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003055-M02, RRID:AB_489853
- Product name
- HCK monoclonal antibody (M02), clone 2A6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HCK.
- Antigen sequence
MGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPT
STIKPGPNSHNSNTPGIREAGSEDIIVVALYDYEA
IHHEDLSFQK- Isotype
- IgG
- Antibody clone number
- 2A6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Analysis of protein-protein interactions in cross-talk pathways reveals CRKL protein as a novel prognostic marker in hepatocellular carcinoma.
Liu CH, Chen TC, Chau GY, Jan YH, Chen CH, Hsu CN, Lin KT, Juang YL, Lu PJ, Cheng HC, Chen MH, Chang CF, Ting YS, Kao CY, Hsiao M, Huang CY
Molecular & cellular proteomics : MCP 2013 May;12(5):1335-49
Molecular & cellular proteomics : MCP 2013 May;12(5):1335-49
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HCK is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between FLT1 and HCK. Huh7 cells were stained with anti-FLT1 rabbit purified polyclonal 1:1200 and anti-HCK mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
