Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN630723 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- GAPDH antibody was raised using the N terminal of GAPDH corresponding to a region with amino acids IDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKW
- Description
- Affinity purified
- Reactivity
- Human, Canine
- Host
- Rabbit
- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
- Handling
- Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
Submitted references Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms.
ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice.
Kuroda E, Ishii KJ, Uematsu S, Ohata K, Coban C, Akira S, Aritake K, Urade Y, Morimoto Y
Immunity 2011 Apr 22;34(4):514-26
Immunity 2011 Apr 22;34(4):514-26
ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice.
Shi J, Zhang YW, Yang Y, Zhang L, Wei L
Journal of molecular and cellular cardiology 2010 Nov;49(5):819-28
Journal of molecular and cellular cardiology 2010 Nov;49(5):819-28
No comments: Submit comment
No validations: Submit validation data