Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN630760 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC
- Description
- Affinity purified
- Reactivity
- Human
- Host
- Rabbit
- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
- Handling
- Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
Submitted references Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms.
ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice.
Calcineurin protects the heart in a murine model of dilated cardiomyopathy.
Diabetes-relevant regulation of cultured blood outgrowth endothelial cells.
Kuroda E, Ishii KJ, Uematsu S, Ohata K, Coban C, Akira S, Aritake K, Urade Y, Morimoto Y
Immunity 2011 Apr 22;34(4):514-26
Immunity 2011 Apr 22;34(4):514-26
ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice.
Shi J, Zhang YW, Yang Y, Zhang L, Wei L
Journal of molecular and cellular cardiology 2010 Nov;49(5):819-28
Journal of molecular and cellular cardiology 2010 Nov;49(5):819-28
Calcineurin protects the heart in a murine model of dilated cardiomyopathy.
Heineke J, Wollert KC, Osinska H, Sargent MA, York AJ, Robbins J, Molkentin JD
Journal of molecular and cellular cardiology 2010 Jun;48(6):1080-7
Journal of molecular and cellular cardiology 2010 Jun;48(6):1080-7
Diabetes-relevant regulation of cultured blood outgrowth endothelial cells.
Wang S, Hirschberg R
Microvascular research 2009 Sep;78(2):174-9
Microvascular research 2009 Sep;78(2):174-9
No comments: Submit comment
No validations: Submit validation data