Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002597-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002597-M03, RRID:AB_1111859
- Product name
- GAPDH monoclonal antibody (M03), clone 1G5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GAPDH.
- Antigen sequence
GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKK
VVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTF
DAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAH
MASKE- Isotype
- IgG
- Antibody clone number
- 1G5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references BLMP-1/Blimp-1 regulates the spatiotemporal cell migration pattern in C. elegans.
Huang TF, Cho CY, Cheng YT, Huang JW, Wu YZ, Yeh AY, Nishiwaki K, Chang SC, Wu YC
PLoS genetics 2014 Jun;10(6):e1004428
PLoS genetics 2014 Jun;10(6):e1004428
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GAPDH monoclonal antibody (M03), clone 1G5. Western Blot analysis of GAPDH expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GAPDH is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of GAPDH transfected lysate using anti-GAPDH monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GAPDH MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol