Antibody data

Product number
ABIN504498
Provider
antibodies-online
Product name
anti-Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) antibody
Provider product page
antibodies-online - ABIN504498
Antibody type
Polyclonal
Antigen
The immunogen for anti-GAPDH antibody: synthetic peptide directed towards the middle region of human GAPDH
Reactivity
Human
Host
Rabbit
Antigen sequence
KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYD
NSLKI ISNASCTTNC
Vial size
50 µg
Provider Type Product Number
- No reagents -