H00008125-M01
antibody from Abnova Corporation
Targeting: ANP32A
C15orf1, I1PP2A, LANP, MAPM, mapmodulin, PHAPI, PP32
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008125-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008125-M01, RRID:AB_464172
- Product name
- ANP32A monoclonal antibody (M01), clone 2G11-4A5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ANP32A.
- Antigen sequence
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLE
GLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLE
LSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLST
IEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLP
QLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDED
EEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEED
EEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEG
EDDD- Isotype
- IgG
- Antibody clone number
- 2G11-4A5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Foamy virus nuclear RNA export is distinct from that of other retroviruses.
Quantitative nanoproteomics for protein complexes (QNanoPX) related to estrogen transcriptional action.
Bodem J, Schied T, Gabriel R, Rammling M, Rethwilm A
Journal of virology 2011 Mar;85(5):2333-41
Journal of virology 2011 Mar;85(5):2333-41
Quantitative nanoproteomics for protein complexes (QNanoPX) related to estrogen transcriptional action.
Cheng PC, Chang HK, Chen SH
Molecular & cellular proteomics : MCP 2010 Feb;9(2):209-24
Molecular & cellular proteomics : MCP 2010 Feb;9(2):209-24
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ANP32A monoclonal antibody (M01), clone 2G11-4A5 Western Blot analysis of ANP32A expression in Hela ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ANP32A monoclonal antibody (M01), clone 2G11-4A5. Western Blot analysis of ANP32A expression in Daudi ( Cat # L001V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ANP32A on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ANP32A on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol