HPA018467

IL16 antibody from Atlas Antibodies
FLJ16806, FLJ42735, HsT19289, IL-16, LCF, prIL-16
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018467
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018467, RRID:AB_1851642
Product name
Anti-IL16
Provider product page
Atlas Antibodies - HPA018467
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSS
AVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNED
SAANGSAETSALDTGFSLNLSELREYTEGLTEAKE
DDDG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -