HPA019764

CDKN2C antibody from Sigma-Aldrich
INK4C, p18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019764
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019764, RRID:AB_1854866
Product name
Anti-CDKN2C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019764
Antibody type
Polyclonal
Antigen
Cyclin-dependent kinase 4 inhibitor C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRT
ALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIH
DAARAGFLDT
Storage
-20C
Provider Type Product Number
- No reagents -