H00005861-M07A

RAB1A antibody from Abnova Corporation
RAB1, YPT1
No application information provided.

Antibody data

Product number
H00005861-M07A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005861-M07A, RRID:AB_1579468
Product name
RAB1A monoclonal antibody (M07A), clone 3F10
Provider product page
Abnova Corporation - H00005861-M07A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RAB1A.
Antigen sequence
LQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAK
EFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKR
MGPGATAGGAEKSNVKIQSTPVKQSGGGC
Isotype
IgM
Antibody clone number
3F10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -