ABIN183030

AK6 antibody from antibodies-online
CINAP
Western blot
Recommended by provider
Immunohistochemistry
Data presented on provider website
Chromatin Immunoprecipitation
Supportive data in Antibodypedia

Antibody data

Product number
ABIN183030
Provider
antibodies-online
Product name
anti-RNA Polymerase II TBP-Associated Factor Subunit G (TAF9) (N-Term) antibody
Provider product page
antibodies-online - ABIN183030
Antibody type
Polyclonal
Antigen
The immunogen for anti-TAF9 antibody: synthetic peptide directed towards the N terminal of human TAF9
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Xenopus
Host
Rabbit
Antigen sequence
GLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVV
DELDN QMREGGVIVD
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -