HPA067703

TBL1X antibody from Atlas Antibodies
EBI, TBL1

Antibody data

Product number
HPA067703
Provider
Atlas Antibodies
Product name
Anti-TBL1X
Provider product page
Atlas Antibodies - HPA067703
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SSSCCHRPAGRGAMQSVLHHFQRLRGREGGSHFIN
TSSPRGEAK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -