HPA000175

SYAP1 antibody from Sigma-Aldrich
FLJ14495, PRO3113
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000175
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000175, RRID:AB_1080142
Product name
Anti-SYAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000175
Antibody type
Polyclonal
Antigen
Synapse-associated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FLRDPPAGVQFNFDFDQMYPVALVMLQEDELLSKM
RFALVPKLVKEEVFWRNYFYRVSLIKQSAQLTALA
AQQQAAGKEEKSNGREQDLPLAEAVRPKTPPVVIK
SQLKTQEDEEE
Storage
-20C
Provider Type Product Number
- No reagents -