Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004086-M02 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004086-M02, RRID:AB_463850
- Product name
- SMAD1 monoclonal antibody (M02), clone 1D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SMAD1.
- Antigen sequence
- MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVD
 ALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRS
 LDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKP
 LECCE
- Isotype
- IgG
- Antibody clone number
- 1D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- SMAD1 monoclonal antibody (M02), clone 1D3. Western Blot analysis of SMAD1 expression in MES-SA/Dx5 ( Cat # L021V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Western Blot analysis of SMAD1 expression in transfected 293T cell line by SMAD1 monoclonal antibody (M02), clone 1D3.Lane 1: SMAD1 transfected lysate(52.3 KDa).Lane 2: Non-transfected lysate.
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Detection limit for recombinant GST tagged SMAD1 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunofluorescence of monoclonal antibody to SMAD1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunoperoxidase of monoclonal antibody to SMAD1 on formalin-fixed paraffin-embedded human salivary gland tissue. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol