Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004854-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004854-M01, RRID:AB_606671
- Product name
- NOTCH3 monoclonal antibody (M01), clone 1G5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NOTCH3.
- Antigen sequence
SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDP
CHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPD
CSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQ
GRSCR- Isotype
- IgG
- Antibody clone number
- 1G5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Von Willebrand factor inhibits mature smooth muscle gene expression through impairment of Notch signaling.
Bidirectional encroachment of collagen into the tunica media in cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy.
Functional analysis of the Notch ligand Jagged1 missense mutant proteins underlying Alagille syndrome.
Transendocytosis is impaired in CADASIL-mutant NOTCH3.
Cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy affecting an African American man: identification of a novel 15-base pair NOTCH3 duplication.
Thrombospondin 2 potentiates notch3/jagged1 signaling.
Identification of Pbx1, a potential oncogene, as a Notch3 target gene in ovarian cancer.
Meng H, Zhang X, Lee SJ, Wang MM
PloS one 2013;8(9):e75808
PloS one 2013;8(9):e75808
Bidirectional encroachment of collagen into the tunica media in cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy.
Dong H, Blaivas M, Wang MM
Brain research 2012 May 25;1456:64-71
Brain research 2012 May 25;1456:64-71
Functional analysis of the Notch ligand Jagged1 missense mutant proteins underlying Alagille syndrome.
Tada M, Itoh S, Ishii-Watabe A, Suzuki T, Kawasaki N
The FEBS journal 2012 Jun;279(12):2096-107
The FEBS journal 2012 Jun;279(12):2096-107
Transendocytosis is impaired in CADASIL-mutant NOTCH3.
Watanabe-Hosomi A, Watanabe Y, Tanaka M, Nakagawa M, Mizuno T
Experimental neurology 2012 Jan;233(1):303-11
Experimental neurology 2012 Jan;233(1):303-11
Cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy affecting an African American man: identification of a novel 15-base pair NOTCH3 duplication.
Lee SJ, Meng H, Elmadhoun O, Blaivas M, Wang MM
Archives of neurology 2011 Dec;68(12):1584-6
Archives of neurology 2011 Dec;68(12):1584-6
Thrombospondin 2 potentiates notch3/jagged1 signaling.
Meng H, Zhang X, Hankenson KD, Wang MM
The Journal of biological chemistry 2009 Mar 20;284(12):7866-74
The Journal of biological chemistry 2009 Mar 20;284(12):7866-74
Identification of Pbx1, a potential oncogene, as a Notch3 target gene in ovarian cancer.
Park JT, Shih IeM, Wang TL
Cancer research 2008 Nov 1;68(21):8852-60
Cancer research 2008 Nov 1;68(21):8852-60
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NOTCH3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol