Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 101-M58 - Provider product page
- Provider
- ReliaTech GmbH
- Product name
- VEGF-A
- Antibody type
- Monoclonal
- Antigen
- recombinant human VEGF165
- Description
- antibody purified from hybridoma supernatant
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVP
TEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECR
PKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCK
NTDSRCKARQLELNERTCRCDKPRR- Isotype
- IgG
- Antibody clone number
- (#7G7)
- Vial size
- 100 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
Submitted references The MSC-MCF-7 Duet Playing Tumor Vasculogenesis and Angiogenesis onto the Chick Embryo Chorioallantoic Membrane.
ComŞa Ş, CeauȘu AR, Popescu R, SÂrb S, CÎmpean AM, Raica M
In vivo (Athens, Greece) 2020 Nov-Dec;34(6):3315-3325
In vivo (Athens, Greece) 2020 Nov-Dec;34(6):3315-3325
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Figure 1. Western analysis of recombinant human VEGF165, mouse VEGFG164 and human VEGF121 using a monoclonal mouse anti-human VEGF-A antibody [Cat# 101-M58]. There is no cross reactivity with mouse VEGF164.
- Sample type
- Purified recombinant proteins
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- VEGF-A Sandwich-ELISA using the monoclonal mouse anti-human VEGF-A antibody [Cat# 101-M58] as capture antibody and recombinant human VEGF189 [Cat# 300-094] as standard. The Biotinylated monoclonal mouse anti-human VEGF-A antibody [Cat# 101-MBi60] was used for detection.
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Immunohistochemistry with a paraffin-bedded section of human Glioblastoma tissue.
- Sample type
- Human Glioblastom