HPA000401

CLCN5 antibody from Atlas Antibodies
ClC-5, CLC5, DENTS, hCIC-K2, hClC-K2, NPHL1, NPHL2, XLRH, XRN
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000401
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000401, RRID:AB_1078531
Product name
Anti-CLCN5
Provider product page
Atlas Antibodies - HPA000401
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EAKEEFAHKTLAMDVMKPRRNDPLLTVLTQDSMTV
EDVETIISETTYSGFPVVVSRESQRLVGFVLRRDL
IISIENARKKQDGVVSTSIIYFTEHSPPLPPYTPP
TLKLQNILDLSPFTVTD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -