HPA000401

CLCN5 antibody from Sigma-Aldrich
ClC-5, CLC5, DENTS, hCIC-K2, hClC-K2, NPHL1, NPHL2, XLRH, XRN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000401
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000401, RRID:AB_1078531
Product name
Anti-CLCN5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000401
Antibody type
Polyclonal
Antigen
Chloride channel protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EAKEEFAHKTLAMDVMKPRRNDPLLTVLTQDSMTV
EDVETIISETTYSGFPVVVSRESQRLVGFVLRRDL
IISIENARKKQDGVVSTSIIYFTEHSPPLPPYTPP
TLKLQNILDLSPFTVTD
Storage
-20C
Provider Type Product Number
- No reagents -