Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007150-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007150-M01, RRID:AB_607206
- Product name
- TOP1 monoclonal antibody (M01), clone 1A1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TOP1.
- Antigen sequence
QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDP
RITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADE
DYEF- Isotype
- IgG
- Antibody clone number
- 1A1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references AID-induced decrease in topoisomerase 1 induces DNA structural alteration and DNA cleavage for class switch recombination.
Kobayashi M, Aida M, Nagaoka H, Begum NA, Kitawaki Y, Nakata M, Stanlie A, Doi T, Kato L, Okazaki IM, Shinkura R, Muramatsu M, Kinoshita K, Honjo T
Proceedings of the National Academy of Sciences of the United States of America 2009 Dec 29;106(52):22375-80
Proceedings of the National Academy of Sciences of the United States of America 2009 Dec 29;106(52):22375-80
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TOP1 monoclonal antibody (M01), clone 1A1. Western Blot analysis of TOP1 expression in human ovarian cancer.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TOP1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to TOP1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to TOP1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1~10 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol