HPA019039

TOP1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019039
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019039, RRID:AB_1858187
Product name
Anti-TOP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019039
Antibody type
Polyclonal
Antigen
DNA topoisomerase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFV
PPKEDIKPLKRPRDEDDADYKPKK
Storage
-20C
Provider Type Product Number
- No reagents -