Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29495 - Provider product page

- Provider
- Abnova Corporation
- Product name
- HMMR polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein corresponding to amino acids of human HMMR.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
KRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKSQR
FKQQKESKQNLNVDKDTTLPASARKVKSSESKKES
QKNDKDLKILEKEIRVLLQERGAQ- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of U-2 OS cells with HMMR polyclonal antibody (Cat# PAB29485) under 1-4 ug/mL working concentration shows positivity in microtubules and centrosome. Antibody staining is shown in green.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with HMMR polyclonal antibody (Cat# PAB29485) shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts at 1:50 - 1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)