Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002956-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002956-M01, RRID:AB_463799
- Product name
- MSH6 monoclonal antibody (M01), clone 1F2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MSH6.
- Antigen sequence
AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCR
TIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTK
KGCKRYWTKTIEKKLANLINAEERRDVSLK- Isotype
- IgG
- Antibody clone number
- 1F2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MSH6 monoclonal antibody (M01), clone 1F2. Western Blot analysis of MSH6 expression in human kidney.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MSH6 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to MSH6 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between MSH2 and MSH6. HeLa cells were stained with anti-MSH2 rabbit purified polyclonal 1:1200 and anti-MSH6 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)