HPA028376

MSH6 antibody from Sigma-Aldrich
GTBP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028376
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028376, RRID:AB_10598909
Product name
Anti-MSH6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028376
Antibody type
Polyclonal
Antigen
mutS homolog 6 (E. coli) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MVENECEDPSQETITFLYKFIKGACPKSYGFNAAR
LANLPEEVIQKGHRKAREFEKMNQSLRLFREVCLA
SERSTV
Storage
-20C
Provider Type Product Number
- No reagents -