Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003843-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003843-M01, RRID:AB_606910
- Product name
- RANBP5 monoclonal antibody (M01), clone 1C4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RANBP5.
- Antigen sequence
MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYEN
IPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLL
SSAFDEVYPALPSDVQTAIKSELLMIIQME- Isotype
- IgG
- Antibody clone number
- 1C4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Fas-Associated Factor 1 Negatively Regulates the Antiviral Immune Response by Inhibiting Translocation of Interferon Regulatory Factor 3 to the Nucleus.
Localization of retinitis pigmentosa 2 to cilia is regulated by Importin beta2.
Song S, Lee JJ, Kim HJ, Lee JY, Chang J, Lee KJ
Molecular and cellular biology 2016 Jan 25;36(7):1136-51
Molecular and cellular biology 2016 Jan 25;36(7):1136-51
Localization of retinitis pigmentosa 2 to cilia is regulated by Importin beta2.
Hurd TW, Fan S, Margolis BL
Journal of cell science 2011 Mar 1;124(Pt 5):718-26
Journal of cell science 2011 Mar 1;124(Pt 5):718-26
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RANBP5 monoclonal antibody (M01), clone 1C4 Western Blot analysis of RANBP5 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of IPO5 expression in transfected 293T cell line by RANBP5 monoclonal antibody (M01), clone 1C4.Lane 1: IPO5 transfected lysate (Predicted MW: 125.6 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RANBP5 monoclonal antibody (M01), clone 1C4. Western Blot analysis of IPO5 expression in PC-12.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RANBP5 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RANBP5 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol