H00084254-B01P

CAMKK1 antibody from Abnova Corporation
CAMKKA, DKFZp761M0423, MGC34095

Antibody data

Product number
H00084254-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084254-B01P, RRID:AB_1237753
Product name
CAMKK1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00084254-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CAMKK1 protein.
Antigen sequence
MEGGPAVCCQDPRAELVERVAAIDVTHLEEADGGP
EPTRNGVDPPPRARAASVIPGSTSRLLPARPSLSA
RKLSLQERPAGSYLEAQAGPYATGPASHISPRAWR
RPTIESHHVAISDAEDCVQLNQYKLQSEIGKGAYG
VVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPP
PRGSQAAQGGPAKQLLPLERVYQEIAILKKLDHVN
VVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDK
PFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSN
LLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPA
FMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGK
CPFIDDFILALHRKIKNEPVVFPEEPEISEELKDL
ILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSE
EEHCSVVEVTEEEVKNSVRLIPSWTTVILVKSMLR
KRSFGNPFEPQARREERSMSAPGNLLVKEGFGEGG
KSPELPGVQEDEAAS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -