H00004093-M05

SMAD9 antibody from Abnova Corporation
MADH6, MADH9, SMAD8, SMAD8/9

Antibody data

Product number
H00004093-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004093-M05, RRID:AB_1137035
Product name
SMAD9 monoclonal antibody (M05), clone 3H2
Provider product page
Abnova Corporation - H00004093-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SMAD9.
Antigen sequence
MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAE
KAVDSLVKKLKKKKGAMDELERALSCPGQPSKCVT
IPRSLDGRLQVSHCKGLPHVIYCRVWRWPDLQSHH
ELKPLECCEFPFGSKQKEVCINPYHYRRVETPVLP
PVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNA
TYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSP
GSPSEPESPYQHSDFRPVCYEEPQHWCSVAYYELN
NRVGETFQASSRSVLIDGFTDPSNNRNRFCLGLLS
NVNRNSTIENTRRHIGKGVHLYYVGGEVYAECVSD
SSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNN
QLFAQLLAQSVHHGFEVVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMG
SPHNPISSVS
Isotype
IgG
Antibody clone number
3H2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -