HPA000611

MAGEB10 antibody from Atlas Antibodies
FLJ32965
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000611
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000611, RRID:AB_2138307
Product name
Anti-MAGEB10
Provider product page
Atlas Antibodies - HPA000611
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LDILEEEEESPPSASACLKDVFQSSLDGASNNPHG
LREAQSTSTSATAASHTRHPEGVNDQMEERPICTQ
DLEATDSFPRGPVDEKVIILVHYLLYKYQMKEPIT
KADMLR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -