HPA000611

MAGEB10 antibody from Sigma-Aldrich
FLJ32965
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000611
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000611, RRID:AB_2138307
Product name
Anti-MAGEB10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000611
Antibody type
Polyclonal
Antigen
Melanoma-associated antigen B10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDILEEEEESPPSASACLKDVFQSSLDGASNNPHG
LREAQSTSTSATAASHTRHPEGVNDQMEERPICTQ
DLEATDSFPRGPVDEKVIILVHYLLYKYQMKEPIT
KADMLR
Storage
-20C
Provider Type Product Number
- No reagents -