HPA044654

CTTNBP2 antibody from Atlas Antibodies
C7orf8, CORTBP2, KIAA1758, Orf4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA044654
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA044654, RRID:AB_2679037
Product name
Anti-CTTNBP2
Provider product page
Atlas Antibodies - HPA044654
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HDVATDDCKHLLENLNALKIPLRISVGEIEPSNYG
SDDLECENTICALNIRKQTSWDDFSKAVSQALTNH
FQAISSDGWWSLEDVTCNNTTDSNIGLSARSIRSI
TLGNVPWSVGQSFAQSPWDFMRKNKAEHITVLLSG
PQEGCLSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -