H00006598-M12

SMARCB1 antibody from Abnova Corporation
BAF47, hSNFS, Ini1, PPP1R144, RDT, Sfh1p, SNF5, SNF5L1, Snr1

Antibody data

Product number
H00006598-M12
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006598-M12, RRID:AB_1137039
Product name
SMARCB1 monoclonal antibody (M12), clone 2D10
Provider product page
Abnova Corporation - H00006598-M12
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SMARCB1.
Antigen sequence
VPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPL
CFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLR
DAFTWNMNE
Isotype
IgG
Antibody clone number
2D10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -