H00006598-M14

SMARCB1 antibody from Abnova Corporation
BAF47, hSNFS, Ini1, PPP1R144, RDT, Sfh1p, SNF5, SNF5L1, Snr1

Antibody data

Product number
H00006598-M14
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006598-M14, RRID:AB_1137036
Product name
SMARCB1 monoclonal antibody (M14), clone 2H1
Provider product page
Abnova Corporation - H00006598-M14
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SMARCB1.
Antigen sequence
VPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPL
CFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLR
DAFTWNMNE
Isotype
IgG
Antibody clone number
2H1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -