HPA018248

SMARCB1 antibody from Sigma-Aldrich
BAF47, hSNFS, Ini1, PPP1R144, RDT, Sfh1p, SNF5L1, Snr1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018248
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018248, RRID:AB_1851162
Product name
Anti-SMARCB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018248
Antibody type
Polyclonal
Antigen
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLR
EQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRM
GRDKKRTFPLCFDDHDPAVIHENASQPE
Storage
-20C
Provider Type Product Number
- No reagents -